ZNF701 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF701 antibody is: synthetic peptide directed towards the middle region of Human ZNF701. Synthetic peptide located within the following region: DFHQKRYLACHRCHTGENPYTCNECGKTFSHNSALLVHKAIHTGEKPYKC
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	zinc finger protein 701
Database Link	NP_060730 Entrez Gene 55762 Human UniProt ID Q9NV72
Background	ZNF701 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and KRAB domain. ZNF701 may be involved in transcriptional regulation.
Synonyms	FLJ10891
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 92%; Zebrafish: 90%; Bovine: 86%; Rat: 83%; Dog: 79%; Pig: 79%; Horse: 79%; Rabbit: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.