PYHIN1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PYHIN1 antibody: synthetic peptide directed towards the N terminal of human PYHIN1. Synthetic peptide located within the following region: KMKEEYDKIQIADLMEEKFPGDAGLGKLIEFFKEIPTLGDLAETLKREKL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	pyrin and HIN domain family member 1
Database Link	NP_945148 Entrez Gene 149628 Human UniProt ID Q6K0P9
Background	PYHIN1 belongs to the HIN-200 family. This protein is major mediator of the tumor suppressor activity of IFN in breast cancer cells. It promotes ubiquitination and subsequent degradation of MDM2, which leads to p53/TP53 stabilization, and HDAC1, which in turn enhances maspin expression, and impairs invasive activity of cancer cells.
Synonyms	IFIX
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.