PYHIN1 Rabbit Polyclonal Antibody
CAT#: TA339836
Rabbit Polyclonal Anti-PYHIN1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 4840.00
CNY 4840.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PYHIN1 antibody: synthetic peptide directed towards the N terminal of human PYHIN1. Synthetic peptide located within the following region: ANNYKKIVLLKGLEVINDYHFRIVKSLLSNDLKLNPKMKEEYDKIQIADL |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 55 kDa |
| Gene Name | pyrin and HIN domain family member 1 |
| Database Link | |
| Background | PYHIN1 belongs to the HIN-200 family. This protein is major mediator of the tumor suppressor activity of IFN in breast cancer cells. It promotes ubiquitination and subsequent degradation of MDM2, which leads to p53/TP53 stabilization, and HDAC1, which in turn enhances maspin expression, and impairs invasive activity of cancer cells. |
| Synonyms | IFIX |
| Note | Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 93%; Dog: 91%; Horse: 91%; Bovine: 91%; Pig: 85%; Rat: 85% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
