LIN9 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LIN9 antibody: synthetic peptide directed towards the N terminal of human LIN9. Synthetic peptide located within the following region: SLQKTPVWKGRNTSSAVEMPFRNSKRSRLFSDEDDRQINTRSPKRNQRVA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	lin-9 DREAM MuvB core complex component
Database Link	NP_775106 Entrez Gene 286826 Human UniProt ID Q5TKA1
Background	LIN9 belongs to the lin-9 family and acts as a tumor suppressor. It inhibits DNA synthesis. Its ability to inhibit oncogenic transformation is mediated through its association with RB1. LIN9 plays a role in the expression of genes required for the G1/S transition.
Synonyms	BARA; BARPsv; Lin-9; TGS; TGS1; TGS2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.