HYAL1 Rabbit Polyclonal Antibody
CAT#: TA339812
Rabbit Polyclonal Anti-HYAL1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-HYAL1 antibody: synthetic peptide directed towards the N terminal of human HYAL1. Synthetic peptide located within the following region: TIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPD |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 45 kDa |
| Gene Name | hyaluronoglucosaminidase 1 |
| Database Link | |
| Background | HYAL1 is a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. This gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene.This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Synonyms | HYAL-1; LUCA1; MPS9; NAT6 |
| Note | Immunogen Sequence Homology: Human: 100%; Horse: 93%; Rabbit: 93%; Rat: 92%; Mouse: 92%; Pig: 86%; Bovine: 86%; Guinea pig: 86%; Dog: 85% |
| Reference Data | |
| Protein Families | Secreted Protein |
| Protein Pathways | Glycosaminoglycan degradation, Lysosome, Metabolic pathways |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
