DNER Rabbit Polyclonal Antibody
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DNER antibody: synthetic peptide directed towards the middle region of human DNER. Synthetic peptide located within the following region: DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDP |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 50 kDa |
Gene Name | delta/notch like EGF repeat containing |
Database Link | |
Background | DNER is an activator of the NOTCH1 pathway. It may mediate neuron-glia interaction during astrocytogenesis. |
Synonyms | bet; UNQ26 |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Bovine: 79%; Guinea pig: 79% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |