Scratch 2 (SCRT2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SCRT2 antibody: synthetic peptide directed towards the middle region of human SCRT2. Synthetic peptide located within the following region: HMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAACAKAAEPPPPTPAGPAS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	scratch family transcriptional repressor 2
Database Link	NP_149120 Entrez Gene 85508 Human UniProt ID Q9NQ03
Background	SCRT2 belongs to the snail C2H2-type zinc-finger protein family. It contains 5 C2H2-type zinc fingers. SCRT2 may be involved in transcriptional regulation.
Synonyms	ZNF898B
Note	Immunogen Sequence Homology: Human: 100%; Yeast: 100%; Dog: 92%; Rat: 85%; Pig: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.