ZBTB46 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZBTB46 antibody: synthetic peptide directed towards the N terminal of human ZBTB46. Synthetic peptide located within the following region: MNNRKEDMEITSHYRHLLRELNEQRQHGVLCDVCVVVEGKVFKAHKNVLL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	zinc finger and BTB domain containing 46
Database Link	NP_079500 Entrez Gene 140685 Human UniProt ID Q86UZ6
Background	ZBTB46 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers. ZBTB46 may be involved in transcriptional regulation.
Synonyms	BTBD4; BZEL; dJ583P15.7; dJ583P15.8; RINZF; ZNF340
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Horse: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.