SMYD3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	10k-ChIP, WB
Recommend Dilution	WB, CHIP
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SMYD3 antibody: synthetic peptide directed towards the N terminal of human SMYD3. Synthetic peptide located within the following region: PRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	SET and MYND domain containing 3
Database Link	NP_073580 Entrez Gene 64754 Human UniProt ID Q9H7B4
Background	SMYD3 is a member of an RNA polymerase complex. Within the RNA polymerase complex, it acts as a histone methyltransferase that plays a role in transcriptional regulation.SMYD3 is a histone methyltransferase that plays a role in transcriptional regulation as a member of an RNA polymerase complex. [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms	bA74P14.1; KMT3E; ZMYND1; ZNFN3A1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.