ZNF708 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF708 antibody: synthetic peptide directed towards the C terminal of human ZNF708. Synthetic peptide located within the following region: ILTKHKVIHTEDKPYKCEECGKTFNYSSNFTNHKKIHTGEKPYKCEECGK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	zinc finger protein 708
Database Link	NP_067092 Entrez Gene 7562 Human UniProt ID P17019
Background	ZNF708 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 15 C2H2-type zinc fingers and 1 KRAB domain. ZNF708 may be involved in transcriptional regulation.
Synonyms	KOX8; ZNF15; ZNF15L1
Note	Immunogen Sequence Homology: Human: 100%; Horse: 86%; Bovine: 86%; Zebrafish: 86%; Rabbit: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.