ZNF20 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF20 antibody is: synthetic peptide directed towards the C-terminal region of ZNF20. Synthetic peptide located within the following region: ECKVCGKAFTCSSSIRYHERTHTGEKPYECKHCGKAFISNYIRYHERTHT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	zinc finger protein 20
Database Link	NP_001190179 Entrez Gene 7568 Human UniProt ID P17024
Background	ZNF20 may be involved in transcriptional regulation.
Synonyms	KOX13
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.