ZFYVE28 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZFYVE28 antibody: synthetic peptide directed towards the N terminal of human ZFYVE28. Synthetic peptide located within the following region: LTRSLEDVRGALRDQALRDLNTYTEKMREALRHFDVLFAEFELSYVSAMV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	zinc finger FYVE-type containing 28
Database Link	NP_001166127 Entrez Gene 57732 Human UniProt ID Q9HCC9
Background	ZFYVE28 contains 1 FYVE-type zinc finger. The exact function of ZFYVE28 remains unknown.
Synonyms	LST2; LYST2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.