ZC3H15 Rabbit Polyclonal Antibody
CAT#: TA339734
Rabbit Polyclonal Anti-ZC3H15 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 1 publication. |
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZC3H15 antibody: synthetic peptide directed towards the middle region of human ZC3H15. Synthetic peptide located within the following region: SGREVFEFRPELVNDDDEEADDTRYTQGTGGDEVDDSVSVNDIDLSLYIP |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 48 kDa |
Gene Name | zinc finger CCCH-type containing 15 |
Database Link | |
Background | ZC3H15 belongs to the ZC3H15/TMA46 family. It contains 2 C3H1-type zinc fingers. ZC3H15 protects DRG1 from proteolytic degradation. |
Synonyms | HT010; LEREPO4; MSTP012 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Yeast: 90%; Zebrafish: 85% |
Reference Data |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Characterization of ZC3H15 as a potential TRAF-2-interacting protein implicated in the NFκB pathway and overexpressed in AML.
,null,
International journal of oncology
,PubMed ID 23624947
[ZC3H15]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |