BRF2 Rabbit Polyclonal Antibody

CAT#: TA339733

Rabbit Polyclonal Anti-BRF2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like (BRF2)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like (BRF2), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like (BRF2), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-BRF2 antibody: synthetic peptide directed towards the middle region of human BRF2. Synthetic peptide located within the following region: PPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAA
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 46 kDa
Gene Name BRF2, RNA polymerase III transcription initiation factor 50 kDa subunit
Background BRF2 is the general activator of RNA polymerase III transcription. BRF2 is the factor exclusively required for RNA polymerase III transcription of genes with promoter elements upstream of the initiation sites.
Synonyms BRFU; TFIIIB50
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...