LIMD1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LIMD1 antibody: synthetic peptide directed towards the N terminal of human LIMD1. Synthetic peptide located within the following region: MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFAT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	LIM domains containing 1
Database Link	NP_055055 Entrez Gene 8994 Human UniProt ID Q9UGP4
Background	LIMD1 may be involved in cell anchoring via focal adhesions and in the cell cycle, particularly during mitosis. LIMD1 functionally interacts with pRB and the loss of which promotes lung carcinogenesis. Some breast tumors also have altered expression of LIMD1 RNA. LIMD1 may represent a critical tumor suppressor gene.
Synonyms	LIM domains containing 1
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.