ZNF829 Rabbit Polyclonal Antibody
CAT#: TA339657
Rabbit Polyclonal Anti-ZNF829 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-DKFZp779O175 antibody: synthetic peptide directed towards the middle region of human DKFZp779O175. Synthetic peptide located within the following region: FGEKHYESKEYGKSFSRGSLVTRHQRIHTGKKPYECKECGKAFSCSSYFS |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 50 kDa |
| Gene Name | zinc finger protein 829 |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | DKFZp686K21248; DKFZp779O175; FLJ27459; MGC129866; MGC129867 |
| Note | Immunogen Sequence Homology: Human: 100%; Dog: 79%; Pig: 79%; Horse: 79%; Bovine: 79%; Rabbit: 79% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
