HELT Rabbit Polyclonal Antibody
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HELT antibody: synthetic peptide directed towards the middle region of human HELT. Synthetic peptide located within the following region: EMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 36 kDa |
Gene Name | helt bHLH transcription factor |
Database Link | |
Background | HELT belongs to the HEY family. It contains 1 basic helix-loop-helix (bHLH) domain and 1orange domain. HELT is a transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3'. |
Synonyms | bHLHb44; HCM1228; HESL; Mgn |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |