ZMYND17 (MSS51) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZMYND17 antibody: synthetic peptide directed towards the C terminal of human ZMYND17. Synthetic peptide located within the following region: SAHRGLYHDFWEEQVETGQTHHPDLVAAFHPGFHSSPDLMEAWLPTLLLL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	MSS51 mitochondrial translational activator
Database Link	NP_001019764 Entrez Gene 118490 Human UniProt ID Q4VC12
Background	ZMYND17 contains 1 MYND-type zinc finger. The exact function of ZMYND17 remains unknown.
Synonyms	ZMYND17
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 79%; Horse: 79%; Bovine: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.