PPAPDC1B (PLPP5) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PPAPDC1B antibody: synthetic peptide directed towards the middle region of human PPAPDC1B. Synthetic peptide located within the following region: KLIVGRPRPDFFYRCFPDGLAHSDLMCTGDKDVVNEGRKSFPSGHSSFAF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	phospholipid phosphatase 5
Database Link	NP_001096029 Entrez Gene 84513 Human UniProt ID Q8NEB5
Background	PPAPDC1B is a multi-pass membrane protein and it belongs to the PA-phosphatase related phosphoesterase family. It may be a metastatic suppressor for hepatocellular carcinoma.
Synonyms	DPPL1; HTPAP; PPAPDC1B
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Dog: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 86%; Rabbit: 79%; Zebrafish: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.