ZDHHC16 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZDHHC16 antibody: synthetic peptide directed towards the N terminal of human ZDHHC16. Synthetic peptide located within the following region: SVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKC
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	zinc finger DHHC-type containing 16
Database Link	NP_115703 Entrez Gene 84287 Human UniProt ID Q969W1
Background	ZDHHC16 may be involved in apoptosis regulation.
Synonyms	APH2; DHHC-16
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.