PCDHA3 Rabbit Polyclonal Antibody
CAT#: TA339585
Rabbit Polyclonal Anti-PCDHA3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PCDHA3 antibody is: synthetic peptide directed towards the middle region of Human PCDHA3. Synthetic peptide located within the following region: ATATVLVSLVESGQAPKASSQASAGATGPEAALVDVNVYLIVAICAVSSL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 104 kDa |
Gene Name | protocadherin alpha 3 |
Database Link | |
Background | PCDHA3 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain. |
Synonyms | PCDH-ALPHA3 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Mouse: 92%; Dog: 85%; Bovine: 85% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |