CTRP1 (C1QTNF1) Rabbit Polyclonal Antibody
CAT#: TA339574
Rabbit Polyclonal Anti-C1QTNF1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-C1QTNF1 antibody: synthetic peptide directed towards the N terminal of human C1QTNF1. Synthetic peptide located within the following region: YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 23 kDa |
| Gene Name | C1q and tumor necrosis factor related protein 1 |
| Database Link | |
| Background | C1QTNF1 may be considered a novel adipokine, providing an important framework to further address the physiological functions and mechanisms of the action of this family of secreted glycoproteins in normal and disease states.It was highly expressed in obese subjects as well as up-regulated in hypertensive patients, and may be a newly identified molecular link between obesity and hypertension. |
| Synonyms | CTRP1; GIP; ZSIG37 |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 77% |
| Reference Data | |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
