GDPD5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GDPD5 antibody is: synthetic peptide directed towards the middle region of Human GDPD5. Synthetic peptide located within the following region: VFALYLAPLTISSPCIMEKKDLGPKPALIGHRGAPMLAPEHTLMSFRKAL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	glycerophosphodiester phosphodiesterase domain containing 5
Database Link	NP_110419 Entrez Gene 81544 Human UniProt ID Q8WTR4
Background	Glycerophosphodiester phosphodiesterases, such as GDPD5, are involved in glycerol metabolism.
Synonyms	GDE2; PP1665
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.