CDA08 (ITFG1) Rabbit Polyclonal Antibody
CAT#: TA339563
Rabbit Polyclonal Anti-ITFG1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ITFG1 antibody: synthetic peptide directed towards the N terminal of human ITFG1. Synthetic peptide located within the following region: TAELFGAEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQNAPYFKP |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 68 kDa |
Gene Name | integrin alpha FG-GAP repeat containing 1 |
Database Link | |
Background | ITFG1 belongs to the TIP family. It contains 1 FG-GAP repeat. ITFG1 is a modulator of T-cell function. It has a protective effect in graft versus host disease model. |
Synonyms | 2310047C21Rik; CDA08; LNKN-1; TIP |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 75% |
Reference Data | |
Protein Families | Secreted Protein, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |