ZNF337 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF337 antibody: synthetic peptide directed towards the middle region of human ZNF337. Synthetic peptide located within the following region: KPFVCQECKRGYTSKSDLTVHERIHTGERPYECQECGRKFSNKSYYSKHL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	87 kDa
Gene Name	zinc finger protein 337
Database Link	NP_056470 Entrez Gene 26152 Human UniProt ID Q9Y3M9
Background	This gene encodes a zinc finger domain containing protein. The function of this protein has yet to be determined. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
Synonyms	OTTHUMP00000030501; OTTHUMP00000030502; zinc finger protein 337
Note	Immunogen Sequence Homology: Human: 100%; Rat: 92%; Mouse: 85%; Dog: 83%; Pig: 83%; Horse: 83%; Rabbit: 83%; Bovine: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.