DUX1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DUX1 antibody is: synthetic peptide directed towards the N-terminal region of Human DUX1. Synthetic peptide located within the following region: QSDALRACFERNLYPGIATKEELAQGIDIPEPRVQIWFQNERSCQLRQHR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	19 kDa
Gene Name	double homeobox 1
Database Link	NP_036278 Entrez Gene 26584 Human UniProt ID O43812
Background	The human genome contains hundreds of repeats of the 3.3-kb family in regions associated with heterochromatin. The DUX gene family, including DUX1, resides within these 3.3-kb repeated elements (Beckers et al., 2001 [PubMed 11245978]). See DUX4 (MIM 606009). [supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: AJ001481.1 [ECO:0000332] ##Evidence-Data-END##
Synonyms	1; double homeobox
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.