SEMA4F Rabbit Polyclonal Antibody
CAT#: TA339403
Rabbit Polyclonal Anti-SEMA4F Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SEMA4F antibody: synthetic peptide directed towards the n terminal of human SEMA4F. Synthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 67 kDa |
Gene Name | ssemaphorin 4F |
Database Link | |
Background | This gene encodes a transmembrane class IV semaphorin family protein, which plays a role in neural development. This gene may be involved in neurogenesis in prostate cancer, the development of neurofibromas, and breast cancer tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012] |
Synonyms | M-SEMA; m-Sema-M; PRO2353; S4F; SEMAM; SEMAW |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Axon guidance |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |