CDT1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human, Rat, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CDT1 antibody: synthetic peptide directed towards the C terminal of human CDT1. Synthetic peptide located within the following region: PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	chromatin licensing and DNA replication factor 1
Database Link	NP_112190 Entrez Gene 67177 MouseEntrez Gene 292071 RatEntrez Gene 81620 Human UniProt ID Q9H211
Background	The protein encoded by this gene is involved in the formation of the pre-replication complex that is necessary for DNA replication. The encoded protein can bind geminin, which prevents replication and may function to prevent this protein from initiating replication at inappropriate origins. Phosphorylation of this protein by cyclin A-dependent kinases results in degradation of the protein. [provided by RefSeq, Mar 2011]
Synonyms	DUP; RIS2
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Rabbit: 93%; Yeast: 85%; Dog: 77%
Reference Data
Protein Families	Stem cell - Pluripotency

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.