PSF1 (GINS1) Rabbit Polyclonal Antibody
CAT#: TA339351
Rabbit Polyclonal Anti-GINS1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 2 publications. |
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GINS1 antibody: synthetic peptide directed towards the N terminal of human GINS1. Synthetic peptide located within the following region: MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 23 kDa |
Gene Name | GINS complex subunit 1 |
Database Link | |
Background | The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4; MIM 610611), Psf1, Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]). [supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: D80008.1, BC012542.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025087, ERS025092 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. |
Synonyms | PSF1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 86% |
Reference Data |
Citations (2)
The use of this Antibodies has been cited in the following citations: |
---|
Tissue-Specific Requirement for the GINS Complex During Zebrafish Development
,Varga, M;Csályi, K;Bertyák, I;Menyhárd, DK;Poole, RJ;Cerveny, KL;Kövesdi, D;Barátki, B;Rouse, H;Vad, Z;Hawkins, TA;Stickney, HL;Cavodeassi, F;Schwarz, Q;Young, RM;Wilson, SW;,
Front Cell Dev Biol
,PubMed ID 32548116
[GINS1]
|
The GINS complex is required for the survival of rapidly proliferating retinal and tectal progenitor cells during zebrafish development
,Varga, M;Csalyi, K;Bertyak, I;Menyhard, DK;Poole, RJ;,
bioRxiv
[GINS1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |