Bcat1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Bcat1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ACVVCPVSDILYKGQMLHIPTMENGPKLASRILGKLTDIQYGRVESDWTI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	branched chain aminotransferase 1, cytosolic
Database Link	NP_001019639 Entrez Gene 12035 Mouse UniProt ID P24288
Background	Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine.
Synonyms	BCAT(c); BCT1; DKFZp686E12175; ECA39; MECA39; PNAS-121; PP18
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 86%; Rat: 82%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.