TRIM48 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TRIM48 antibody: synthetic peptide directed towards the C terminal of human TRIM48. Synthetic peptide located within the following region: NVETTRISHWKAFGDILYRSESVLLHMPQPLNLALRAGPITGLRDRLNQF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	tripartite motif containing 48
Database Link	NP_077019 Entrez Gene 79097 Human UniProt ID Q8IWZ4
Background	TRIM48 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger, 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of TRIM48 remains unknown.
Synonyms	RNF101
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.