PTIP (PAXIP1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PAXIP1 antibody: synthetic peptide directed towards the N terminal of human PAXIP1. Synthetic peptide located within the following region: MFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	74 kDa
Gene Name	PAX interacting protein 1
Database Link	NP_031375 Entrez Gene 22976 Human UniProt ID Q6ZW49
Background	PAXIP1 functions as a key component of the DNA damage response, and phosphoserine or phosphothreonine-specific binding modules. PAXIP1 recognizes substrates phosphorylated by the kinases ataxia telangiectasia-mutated (ATM), ataxia telangiectasia and RAD3-related (ATR) in response to gamma irradiation. It may play a role in PAX2-dependent transcriptional regulation. PAXIP1 plays a role in early development, most probably in cell proliferation.
Synonyms	CAGF28; CAGF29; PACIP1; PAXIP1L; PTIP; TNRC2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.