MBNL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MBNL2 antibody: synthetic peptide directed towards the middle region of human MBNL2. Synthetic peptide located within the following region: ENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Database Link	NP_005748 Entrez Gene 10150 Human
Background	MBNL2 is a C3H-type zinc finger protein, which is similar to the Drosophila melanogaster muscleblind B protein.MBNL2 is a RNA-binding protein that binds to 5'ACACCC-3' core sequence. It binds to CUG triplet repeat expansion in myotonic dystrophy muscle cells by sequestering the target RNAs. MBNL2 seems to regulate expression and localization of ITGA3 by transporting it from the nucleus to cytoplasm. It may play a role in myotonic dystrophy pathophysiology (DM).
Synonyms	DKFZp781H1296; MBLL; MBLL39; MGC120625; MGC120626; MGC120628; muscleblind-like 2; muscleblind-like 2 (Drosophila); OTTHUMP00000018578; OTTHUMP00000040762; OTTHUMP00000178763; PRO2032
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 93%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.