CCDC19 (CFAP45) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CCDC19 antibody: synthetic peptide directed towards the N terminal of human CCDC19. Synthetic peptide located within the following region: SLIISPEEFERIKWASHVLTREELEARDQAFKKEKEATMDAVMTRKKIMK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	cilia and flagella associated protein 45
Database Link	NP_036469 Entrez Gene 25790 Human UniProt ID Q9UL16
Background	The function remains unknown.
Synonyms	CCDC19; NESG1
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Bovine: 92%; Guinea pig: 92%; Horse: 85%; Rabbit: 85%; Dog: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.