EVA1 (MPZL2) Rabbit Polyclonal Antibody

CAT#: TA339027

Rabbit Polyclonal Anti-MPZL2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human myelin protein zero-like 2 (MPZL2), transcript variant 2, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of myelin protein zero-like 2 (MPZL2), transcript variant 2
    • 100 ug

CNY 3080.00


Recombinant protein of human myelin protein zero-like 2 (MPZL2), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of myelin protein zero-like 2 (MPZL2), transcript variant 1
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-MPZL2 antibody: synthetic peptide directed towards the N terminal of human MPZL2. Synthetic peptide located within the following region: LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPF
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 22 kDa
Gene Name myelin protein zero like 2
Background Thymus development depends on a complex series of interactions between thymocytes and the stromal component of the organ. Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis. It is highly homologous to the myelin protein zero and, in thymus-derived epithelial cell lines, is poorly soluble in nonionic detergents, strongly suggesting an association to the cytoskeleton. Its capacity to mediate cell adhesion through a homophilic interaction and its selective regulation by T cell maturation might imply the participation of EVA in the earliest phases of thymus organogenesis. The protein bears a characteristic V-type domain and two potential N-glycosylation sites in the extracellular domain; a putative serine phosphorylation site for casein kinase 2 is also present in the cytoplasmic tail. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Synonyms EVA; EVA1
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Guinea pig: 93%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...