eIF1A (EIF1AX) Rabbit Polyclonal Antibody
CAT#: TA338990
Rabbit Polyclonal Anti-EIF1AX Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-EIF1AX antibody: synthetic peptide directed towards the middle region of human EIF1AX. Synthetic peptide located within the following region: KYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDD |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 16 kDa |
Gene Name | eukaryotic translation initiation factor 1A, X-linked |
Database Link | |
Background | This gene encodes an essential eukaryotic translation initiation factor. The protein is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA. [provided by RefSeq, Jul 2008] |
Synonyms | eIF-1A; eIF-4C; EIF1A; EIF1AP1; EIF4C |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 92% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |