OSTA (SLC51A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-OSTalpha antibody: synthetic peptide directed towards the middle region of human OSTalpha. Synthetic peptide located within the following region: LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	solute carrier family 51 alpha subunit
Database Link	NP_689885 Entrez Gene 200931 Human UniProt ID Q86UW1
Background	SLC51A is essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood.SLC51A efficiently transports the major species of bile acids.
Synonyms	OSTA; OSTalpha
Note	Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 92%; Rat: 92%; Rabbit: 92%; Guinea pig: 92%; Bovine: 86%; Mouse: 83%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.