TENT5A Rabbit Polyclonal Antibody
CAT#: TA338892
Rabbit Polyclonal Anti-FAM46A Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-FAM46A antibody is: synthetic peptide directed towards the middle region of Human FAM46A. Synthetic peptide located within the following region: SETIPIHGRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 57 kDa |
Gene Name | family with sequence similarity 46 member A |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | C6orf37; XTP11 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 92%; Zebrafish: 92%; Pig: 86%; Horse: 86%; Bovine: 86%; Rabbit: 85%; Guinea pig: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |