C9orf98 (AK8) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-AK8 antibody is: synthetic peptide directed towards the C-terminal region of Human AK8. Synthetic peptide located within the following region: FDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	adenylate kinase 8
Database Link	NP_689785 Entrez Gene 158067 Human UniProt ID Q96MA6
Background	AK8 is a adenylate kinase. It has highest activity toward AMP, and weaker activity toward dAMP, CMP and dCMP.
Synonyms	AK 8; C9orf98; DDX31
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rat: 92%; Guinea pig: 92%; Horse: 86%; Mouse: 85%; Rabbit: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.