KANSL1L Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-KANSL1L antibody is: synthetic peptide directed towards the C-terminal region of Human KANSL1L. Synthetic peptide located within the following region: TWLQAQISDLECKIQQLTDIHRQIRASKGIVVLEECQLPKDILKKQMQFA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	77 kDa
Gene Name	KAT8 regulatory NSL complex subunit 1 like
Database Link	NP_689732 Entrez Gene 151050 Human UniProt ID A0AUZ9
Background	The function of this protein remains unknown.
Synonyms	C2orf67; MSL1v2
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.