PIWIL4 Rabbit Polyclonal Antibody
CAT#: TA338845
Rabbit Polyclonal Anti-PIWIL4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PIWIL4 antibody: synthetic peptide directed towards the N terminal of human PIWIL4. Synthetic peptide located within the following region: LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 96 |
| Gene Name | piwi like RNA-mediated gene silencing 4 |
| Database Link | |
| Background | PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells. |
| Synonyms | HIWI2; MIWI2 |
| Note | Immunogen Sequence Homology: Human: 100% |
| Reference Data | |
| Protein Pathways | Dorso-ventral axis formation |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
