KCNMB3 Rabbit Polyclonal Antibody
CAT#: TA338746
Rabbit Polyclonal Anti-KCNMB3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KCNMB3 antibody: synthetic peptide directed towards the middle region of human KCNMB3. Synthetic peptide located within the following region: SLTLLGGALIVGMVRLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLC |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 31 kDa |
Gene Name | potassium calcium-activated channel subfamily M regulatory beta subunit 3 |
Database Link | |
Background | MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which may partially inactivate or slightly decrease the activation time of MaxiK alpha subunit currents. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 22. [provided by RefSeq, Jul 2009] |
Synonyms | BKBETA3; HBETA3; K(VCA)BETA-3; KCNMB2; KCNMBL; SLO-BETA-3; SLOBETA3 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 92%; Dog: 91% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Protein Pathways | Vascular smooth muscle contraction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |