KCNK4 Rabbit Polyclonal Antibody

CAT#: TA338723

Rabbit Polyclonal Anti-KCNK4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of potassium channel, subfamily K, member 4 (KCNK4)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human potassium channel, subfamily K, member 4 (KCNK4), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human potassium channel, subfamily K, member 4 (KCNK4), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-KCNK4 antibody: synthetic peptide directed towards the N terminal of human KCNK4. Synthetic peptide located within the following region: MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAH
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 43 kDa
Gene Name potassium two pore domain channel subfamily K member 4
Background Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The encoded protein homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids. [provided by RefSeq, Jul 2008]
Synonyms K2p4.1; TRAAK; TRAAK1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 79%; Guinea pig: 79%
Reference Data
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...