TRPM8 Rabbit Polyclonal Antibody
CAT#: TA338711
Rabbit Polyclonal Anti-TRPM8 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 2 publications. |
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TRPM8 antibody: synthetic peptide directed towards the N terminal of human TRPM8. Synthetic peptide located within the following region: YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 128 kDa |
Gene Name | transient receptor potential cation channel subfamily M member 8 |
Database Link | |
Background | TRPM8 is the receptor-activated non-selective cation channel involved in detection of sensations such as coolness, by being activated by cold temperature below 25 degrees Celsius. TRPM8 is activated by icilin, eucalyptol, menthol, cold and modulation of intracellular pH. TRPM8 is involved in menthol sensation. TRPM8 is permeable for monovalent cations sodium, potassium, and cesium and divalent cation calcium. Temperature sensing is tightly linked to voltage-dependent gating. TRPM8 was activated upon depolarization, changes in temperature resulting in graded shifts of its voltage-dependent activation curves. The chemical agonists menthol functions as a gating modifier, shifting activation curves towards physiological membrane potentials. Temperature sensitivity arises from a tenfold difference in the activation energies associated with voltage-dependent opening and closing. |
Synonyms | LTRPC6; TRPP8 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane |
Citations (2)
The use of this Antibodies has been cited in the following citations: |
---|
Phospholipase C δ4 regulates cold sensitivity in mice
,null,
The Journal of Physiology
,PubMed ID 27062607
[TRPM8]
|
Aberrantly Over-Expressed TRPM8 Channels in Pancreatic Adenocarcinoma: Correlation with Tumor Size/Stage and Requirement for Cancer Cells Invasion
,null,
Cells
,PubMed ID 24861976
[TRPM8]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |