KCNK13 Rabbit Polyclonal Antibody
CAT#: TA338706
Rabbit Polyclonal Anti-KCNK13 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC, IF |
Reactivity | Human, Dog |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KCNK13 antibody: synthetic peptide directed towards the C terminal of human KCNK13. Synthetic peptide located within the following region: GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 45 kDa |
Gene Name | potassium two pore domain channel subfamily K member 13 |
Database Link | |
Background | Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a potassium channel containing two pore-forming domains. This protein is an open channel that can be stimulated by arachidonic acid and inhibited by the anesthetic halothane. [provided by RefSeq, Jul 2013] |
Synonyms | K2p13.1; THIK-1; THIK1 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 79%; Rat: 79%; Horse: 79% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Potassium, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |