TREML2 Rabbit Polyclonal Antibody
CAT#: TA338679
Rabbit Polyclonal Anti-TREML2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TREML2 antibody: synthetic peptide directed towards the N terminal of human TREML2. Synthetic peptide located within the following region: GRYWCMRNTSGILYPLMGFQLDVSPAPQTERNIPFTHLDNILKSGTVTTG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 41 kDa |
Gene Name | triggering receptor expressed on myeloid cells like 2 |
Database Link | |
Background | TREML2 is a single-pass type I membrane protein, and it contains 1 Ig-like V-type (immunoglobulin-like) domain. TREML2 is a cell surface receptor that may play a role in the innate and adaptive immune response. |
Synonyms | C6orf76; dJ238O23.1; TLT-2; TLT2 |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 92%; Bovine: 92%; Rabbit: 86%; Pig: 85%; Dog: 77%; Rat: 77% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |