SRD5A3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SRD5A3 antibody: synthetic peptide directed towards the N terminal of human SRD5A3. Synthetic peptide located within the following region: GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	steroid 5 alpha-reductase 3
Database Link	NP_078868 Entrez Gene 79644 Human UniProt ID Q9H8P0
Background	SRD5A3 belongs to the steroid 5-alpha reductase family and converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT).
Synonyms	CDG1P; CDG1Q; KRIZI; SRD5A2L; SRD5A2L1
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Yeast: 89%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Androgen and estrogen metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.