TMEM106C Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM106C antibody: synthetic peptide directed towards the middle region of human TMEM106C. Synthetic peptide located within the following region: NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	transmembrane protein 106C
Database Link	NP_076961 Entrez Gene 79022 Human UniProt ID Q9BVX2
Background	It belongs to TMEM106 family. The exact function of TMEM106C remains unknown.
Synonyms	MGC5576; MGC111210
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rat: 93%; Pig: 92%; Guinea pig: 92%; Horse: 86%; Mouse: 85%; Bovine: 85%; Yeast: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.