Lrrc19 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Lrrc19 antibody is synthetic peptide directed towards the middle region of Mouse Lrrc19. Synthetic peptide located within the following region: LTWTSEHEPLGKSWAFLVGVVATVLLTSLLIFIAIKCPVWYNILLSYNHH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	leucine rich repeat containing 19
Database Link	NP_780514 Entrez Gene 100061 Mouse UniProt ID Q8BZT5
Background	The function of this protein remains unknown.
Synonyms	FLJ21302
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Rabbit: 93%; Pig: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.