ACCN4 (ASIC4) Rabbit Polyclonal Antibody
CAT#: TA338588
Rabbit Polyclonal Anti-ACCN4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ACCN4 antibody: synthetic peptide directed towards the middle region of human ACCN4. Synthetic peptide located within the following region: NLTRYGKEISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 73 kDa |
Gene Name | acid sensing ion channel subunit family member 4 |
Database Link | |
Background | This gene belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. This gene is predominantly expressed in the pituitary gland, and was considered a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder, however, no correlation was found between mutations in this gene and PDC. [provided by RefSeq, Feb 2012] |
Synonyms | ACCN4; BNAC4 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Other |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |